PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678293295
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family BES1
Protein Properties Length: 314aa    MW: 33553.5 Da    PI: 8.9235
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678293295genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822210.83.4e-65241551133
     DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslks 100
                g+++rkp+w+ErEnn+rRERrRRa+aakiyaGLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg  p    e++g+sa+++p+ss + s+ s
  678293295  24 GSGRRKPSWRERENNRRRERRRRAVAAKIYAGLRAQGNYNLPKHCDNNEVLKALCTEAGWIVEPDGTTYRKGWTPC-PIEIGGTSANMTPSSSRNPSPPS 122
                6899************************************************************************.*********************** PP

     DUF822 101 salaspvesysaspksssfpspssldsislasa 133
                s++asp++sy++sp+sssfpsps+ d +  +++
  678293295 123 SYFASPIPSYQPSPSSSSFPSPSRHDPNGFSNP 155
                **************************9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.0E-6025148IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MVWEGGGGGG GGGGGGGGGG SEGGSGRRKP SWRERENNRR RERRRRAVAA KIYAGLRAQG  60
NYNLPKHCDN NEVLKALCTE AGWIVEPDGT TYRKGWTPCP IEIGGTSANM TPSSSRNPSP  120
PSSYFASPIP SYQPSPSSSS FPSPSRHDPN GFSNPFAFLL NSLPATIPPL RISNSAPVTP  180
PLLSPRKLPK QTINLEADPI SATSVPFFAA SAPASPIRGQ RFTPVTIPEC DESETSSTVD  240
SGQWMNFHTH PNVMIPTSPT FNLIQPTAAA VLRDPSQAPL MLDNDKVKPW EGERIHDVGM  300
DDLELTLGSG SRRV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12645RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-128PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3072e-97BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A068UH771e-120A0A068UH77_COFCA; Uncharacterized protein
STRINGSolyc04g079980.2.11e-114(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.29e-77BES1 family protein